Cagrilintide 5mg v modrej laboratórnej ampulke ako výskumná zlúčenina pre štúdium amylínových receptorov a energie buniek

Cagrilintide 5 mg – Powder

Sale price  2.004,00 Kč Regular price  2.721,00 Kč
Skip to product information
Cagrilintide 5mg v modrej laboratórnej ampulke ako výskumná zlúčenina pre štúdium amylínových receptorov a energie buniek

Cagrilintide 5 mg – Powder

Cagrilintide is a synthetic long-acting amylin analogue with an eicosanoyl side chain. Its binding to AMY1-3 complexes and interaction with GLP-1 agonists in in-vitro receptor models are being investigated in scientific literature.

Sale price  2.004,00 Kč Regular price  2.721,00 Kč

Independently Tested

We guarantee the highest standards thanks to regular analyses in independent laboratories, which confirm the maximum purity and first-class quality of each and every batch.

14-day money-back guarantee

We stand by the uncompromising purity of our products, and to give you complete confidence in your purchase, we offer a 14-day satisfaction guarantee.

Quick delivery

We pride ourselves on lightning-fast processing of every order and secure delivery to you. Plus, when you spend over €100, you get completely free shipping.

Cagrilintide is a synthetic reference peptide analog of amylin with an added eicosanoic (C20 diacid) side chain allowing albumin binding. It is described in published literature as an agonist of heterodimeric amylin receptor complexes AMY1-3 (calcitonin receptor in combination with RAMPs).

Investigated biochemical pathways (academic context)

  • AMY1-3 receptor agonism: in-vitro binding assays on cloned AMY receptor complexes.

  • Receptor pharmacology: characterization of signaling cascades in isolated cell models.

  • Academic research area: referenced in studies of energy homeostasis regulation within the research area of metabolic diseases.

  • Extended pharmacokinetics: in-vitro models of albumin binding as a subject of pharmacokinetic research.

  • Combination studies: academic interest in synergy with GLP-1 agonists (e.g., the so-called CagriSema combination) at the level of in-vitro models.

Laboratory use and storage

Suitable as a reference standard for HPLC and in-vitro receptor assays. In laboratory practice, lyophilized peptides are handled using appropriate sterile media. A compatible solvent intended exclusively for research purposes can be found in our offer as Bacteriostatic Water - 10 ml. Store lyophilized material at -20 °C, protected from light.

Product purpose

This material is sold exclusively as a reference standard for laboratory and in-vitro research, biochemical analysis, and educational purposes. It is not intended for human consumption, therapeutic use, topical application, ingestion, inhalation, or veterinary purposes. It is not a medicine, dietary supplement, cosmetic, or medical device.

Access

Sales are subject to confirmation of age 18+ and declaration of research or collection purpose upon order completion.

Storage and handling

In laboratory practice, lyophilized peptides are handled using appropriate sterile media. A compatible solvent intended exclusively for research purposes can be found in our offer as Bacteriostatic Water - 10 ml. To maintain the stability of the material's structure, cold storage and protection from light are recommended.

Purity
≥ 98%
Quality Certificate
Form
Lyophilized Peptide Powder
Molecular weight
≈ 4409.01 g·mol⁻¹
Packaging
Glass vial with sterile cap
Storage
Lyophilized store at 2–8 °C (dried, protect from light)
Molecular formula
C194H312N54O59S2
Contents
5 mg
Sequence
{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
CAS number
1415456-99-3

Recommended products

Why choose Cerebrotech?


In an area where the purity and stability of substances are crucial, Cerebrotech is a symbol of uncompromising quality. Our products undergo multi-stage control in independent laboratories, thereby guaranteeing purity exceeding 98%. Each sample is carefully lyophilized and packaged in inert glass, which ensures its maximum integrity during storage. We are a partner for those who demand transparency, technical precision, and lightning-fast delivery without compromise.

Important Disclaimer Regarding Information Purpose:
All information provided on this page is solely for educational and informational purposes and is based on current knowledge from scientific papers and preclinical studies in the field of biotechnology. Descriptions of peptide mechanisms of action in laboratory models are not intended as a guide for treatment, diagnosis, or recommendations for human or veterinary use. The products offered are classified as research material intended exclusively for laboratory purposes and scientific experiments in a controlled environment; the seller does not approve or take responsibility for their misuse for purposes other than declared research or collection.